Imagine indisponibilăAntibodiesA325616
Recombinant Human NRG1 Type II Protein (C-terminal His Tag)
998,25 – 43.556,98 lei825,00 – 35.997,50 leiTVA inclus (21%)fără TVA
Recombinant Human NRG1 Type II Protein
Pe scurt
Recombinant Human NRG1 Type II Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63582, pentru ținta NRG1 Type II. Se livrează în mărimile 10µg, 50µg și 1mg, la prețuri între 1.730,30 și 12.744,33 lei cu TVA.
Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.
Specificații
- Brand
- Antibodies
- Mărimi disponibile
- 10µg · 50µg · 1mg
- Țintă
- NRG1 Type II
- Applications
- Cell Proliferation Assay
- Product form
- Lyophilized
- Concentration
- Reconstitution dependent.
- Expression system
- Escherichia coli
- Nature
- Recombinant
- Protein species
- Human
- Reconstitution
- Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions.
- Protein Length
- Protein fragment
- Secvență
- SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ
- Activitate biologică
- ED50: 2.0 x 10^5 U/mg.
Documentație
Produse similare
- Imagine indisponibilă
- Imagine indisponibilăAntibodiesA63581
Recombinant Human GDNF Protein
1.730,30 – 41.460,65 lei1.430,00 – 34.265,00 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA63583
Recombinant Human GMFB Protein
1.730,30 – 41.460,65 lei1.430,00 – 34.265,00 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA63580
Recombinant Human Neurogranin Protein (N-terminal His Tag)
1.963,23 – 45.819,68 lei1.622,50 – 37.867,50 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA63584
Recombinant Human PEDF Protein
1.730,30 – 31.211,95 lei1.430,00 – 25.795,00 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA63579
Recombinant Human CNTF Protein
1.730,30 – 24.423,85 lei1.430,00 – 20.185,00 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA63585
Recombinant Human NT-4 Protein
1.730,30 – 41.460,65 lei1.430,00 – 34.265,00 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA63578
Recombinant Human Neurotrophin 3 Protein
1.730,30 – 41.460,65 lei1.430,00 – 34.265,00 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA63586
Recombinant Human GMFG Protein
1.963,23 – 24.623,50 lei1.622,50 – 20.350,00 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA63577
Recombinant Mouse GDNF Protein
1.730,30 – 41.460,65 lei1.430,00 – 34.265,00 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA63587
Recombinant Mouse Neurotrophin 3 Protein
1.730,30 – 41.460,65 lei1.430,00 – 34.265,00 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA63576
Recombinant Human BDNF Protein
1.730,30 – 41.460,65 lei1.430,00 – 34.265,00 leiTVA inclus (21%)fără TVA