Imagine indisponibilăAntibodiesA63204
Recombinant Human CTGF Protein (N-terminal His Tag)
1.963,23 – 24.623,50 lei1.622,50 – 20.350,00 leiTVA inclus (21%)fără TVA
Recombinant Human CTGF Protein (His Tag)
Pe scurt
Recombinant Human CTGF Protein (His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63073, pentru ținta CTGF. Se livrează în mărimile 4µg, 20µg și 1mg, la prețuri între 1.730,30 și 21.761,85 lei cu TVA.
Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.
Specificații
- Brand
- Antibodies
- Mărimi disponibile
- 4µg · 20µg · 1mg
- Țintă
- CTGF
- Applications
- SDS-PAGE
- Formulation
- Lyophilized without additives.
- Product form
- Lyophilized
- Concentration
- Reconstitution dependent.
- Expression system
- Escherichia coli
- Nature
- Recombinant
- Protein species
- Human
- Reconstitution
- Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions.
- Protein Length
- Protein fragment
- Secvență
- YRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVRPCEADLEENI
Documentație
Produse similare
- Imagine indisponibilă
- Imagine indisponibilăAntibodiesA63215
Recombinant Human CTGF Protein (C-terminal 6 x His Tag)
1.963,23 – 47.716,35 lei1.622,50 – 39.435,00 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA63391
Recombinant Human CTGF Protein
1.730,30 – 31.211,95 lei1.430,00 – 25.795,00 leiTVA inclus (21%)fără TVA
- Imagine indisponibilă
- Imagine indisponibilă
- Imagine indisponibilă
- Imagine indisponibilă
- Imagine indisponibilă
- Imagine indisponibilă
- Imagine indisponibilă
- Imagine indisponibilă
- Imagine indisponibilă