Imagine indisponibilăRecombinant Human BAFF-R Protein
Pe scurt
Recombinant Human BAFF-R Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61634, pentru ținta BAFF-R. Se livrează în mărimile 10µg, 50µg și 1mg, la prețuri între 1.730,30 și 15.905,45 lei cu TVA.
Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.
Specificații
- Brand
- Antibodies
- Mărimi disponibile
- 10µg · 50µg · 1mg
- Țintă
- BAFF-R
- Applications
- SDS-PAGE
- Product form
- Lyophilized
- Concentration
- 1 mg/ml
- Expression system
- Escherichia coli
- Nature
- Recombinant
- Protein species
- Human
- Reconstitution
- Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions.
- Protein Length
- Protein fragment
- Secvență
- MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG
- Activitate biologică
- ED50: 1-5 µg/ml, as determined by its ability to block BAFF induced mouse splenocyte survival, in the presence of 1 µg/ml of human soluble BAFF.
Documentație
Produse similare
Imagine indisponibilă
Imagine indisponibilă
Imagine indisponibilă
Imagine indisponibilă
Imagine indisponibilăAntibodiesA121788Anti-BAFF-R Antibody [11C1]
1.331,00 – 2.262,70 lei1.100,00 – 1.870,00 leiTVA inclus (21%)fără TVA
Imagine indisponibilă
Imagine indisponibilă
Imagine indisponibilă
Imagine indisponibilă
Imagine indisponibilă
Imagine indisponibilăAntibodiesA251401Anti-BAFF-R Antibody [BAFFR/1557] - BSA and Azide free
3.826,63 lei3.162,50 leiTVA inclus (21%)fără TVA
Imagine indisponibilăAntibodiesA251402Anti-BAFF-R Antibody [BAFFR/1558] - BSA and Azide free
3.826,63 lei3.162,50 leiTVA inclus (21%)fără TVA