Imagine indisponibilăAntibodiesA83070
Anti-RACGAP1/MGCRACGAP Antibody - Identical to Novus (NB100-884)
1.297,73 – 3.527,15 lei1.072,50 – 2.915,00 leiTVA inclus (21%)fără TVA
Anti-RACGAP1/MGCRACGAP Antibody [ARC2394]
Pe scurt
Anti-RACGAP1/MGCRACGAP Antibody [ARC2394] este un anticorp monoclonal de iepure împotriva țintei RACGAP1/MGCRACGAP, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA.
Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.
Descriere
Rabbit monoclonal [ARC2394] antibody to RACGAP1/MGCRACGAP.
Specificații
- Brand
- Antibodies
- Mărime
- 100µl
- Țintă
- RACGAP1/MGCRACGAP
- Applications
- WB
- Reactivity
- Human, Mouse, Rat
- Conjugate
- Unconjugated
- Formulation
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
- Host
- Rabbit
- Clonality
- Monoclonal
- Product form
- Liquid
- Concentration
- Lot Specific
- Purification
- Affinity purification.
- Isotype
- IgG
- Recommended dilutions
- WB: 1:500-1:1,000
- Molecular weight
- 70 kDa
- Clonă
- ARC2394
- Secvență
- MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQI
- Imunogen
- A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RGAP1 (Q9H0H5).
Documentație
Produse similare
- Imagine indisponibilă
- Imagine indisponibilă
- Imagine indisponibilă
- Imagine indisponibilăAntibodiesA5908
Human RACGAP1/MGCRACGAP ELISA Kit
4.259,20 – 5.523,65 lei3.520,00 – 4.565,00 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA307174
Anti-Retinoid X Receptor alpha/RXRA Antibody [ARC0468]
3.094,58 lei2.557,50 leiTVA inclus (21%)fără TVA
- Imagine indisponibilă
- Imagine indisponibilăAntibodiesA307173
Anti-Estrogen Related Receptor gamma Antibody [ARC1653]
3.094,58 lei2.557,50 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA307179
Anti-alpha-synuclein + beta Synuclein Antibody [ARC1181]
3.094,58 lei2.557,50 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA307172
Anti-PHD1/prolyl hydroxylase Antibody [ARC0230]
3.094,58 lei2.557,50 leiTVA inclus (21%)fără TVA
- Imagine indisponibilă
- Imagine indisponibilă
- Imagine indisponibilă