Imagine indisponibilăAnti-Profilin 1 Antibody [ARC1469]
Pe scurt
Anti-Profilin 1 Antibody [ARC1469] este un anticorp monoclonal de iepure împotriva țintei Profilin 1, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA.
Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.
Descriere
Rabbit monoclonal [ARC1469] antibody to Profilin 1.
Specificații
- Brand
- Antibodies
- Mărime
- 100µl
- Țintă
- Profilin 1
- Applications
- WB
- Reactivity
- Human, Mouse, Rat
- Conjugate
- Unconjugated
- Formulation
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
- Host
- Rabbit
- Clonality
- Monoclonal
- Product form
- Liquid
- Concentration
- Lot Specific
- Purification
- Affinity purification.
- Isotype
- IgG
- Recommended dilutions
- WB: 1:500-1:2,000
- Molecular weight
- 15 kDa
- Clonă
- ARC1469
- Secvență
- VNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY
- Imunogen
- A synthetic peptide corresponding to a sequence within amino acids 61-140 of human Profilin1 (P07737).
Documentație
Produse similare
- Imagine indisponibilă
- Imagine indisponibilă
- Imagine indisponibilă
- Imagine indisponibilăAntibodiesA60953
Recombinant Rat Profilin 1 Protein (N-terminal His Tag)
1.963,23 – 24.623,50 lei1.622,50 – 20.350,00 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA60811
Recombinant Human Profilin 1 Protein
1.963,23 – 16.837,15 lei1.622,50 – 13.915,00 leiTVA inclus (21%)fără TVA
- Imagine indisponibilă
- Imagine indisponibilă
- Imagine indisponibilăAntibodiesA5168
Human Profilin 1 ELISA Kit
4.259,20 – 5.523,65 lei3.520,00 – 4.565,00 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA309088
Anti-DKC1/Dyskerin Antibody [ARC1063]
3.094,58 lei2.557,50 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA309091
Anti-Human Coronavirus Spike glycoprotein Antibody
2.662,00 lei2.200,00 leiTVA inclus (21%)fără TVA
- Imagine indisponibilă
- Imagine indisponibilăAntibodiesA309093
Anti-Tryptophanyl tRNA synthetase/WRS Antibody [ARC2687]
3.094,58 lei2.557,50 leiTVA inclus (21%)fără TVA