Imagine indisponibilăAnti-PATZ1 Antibody [ARC67668]
Pe scurt
Anti-PATZ1 Antibody [ARC67668] este un anticorp monoclonal de iepure împotriva țintei PATZ1, cu reactivitate declarată pentru Human. Este validat pentru WB, ELISA, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.861,65 lei cu TVA.
Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.
Descriere
Rabbit monoclonal [ARC67668] antibody to PATZ1.
Specificații
- Brand
- Antibodies
- Mărime
- 100µl
- Țintă
- PATZ1
- Applications
- WB, ELISA
- Reactivity
- Human
- Conjugate
- Unconjugated
- Formulation
- Supplied in Phosphate Buffered Saline, pH 7.3, with 0.05% BSA, 50% Glycerol, and 0.05% ProClin 300.
- Host
- Rabbit
- Clonality
- Monoclonal
- Product form
- Liquid
- Concentration
- Lot Specific
- Purification
- Affinity purification.
- Isotype
- IgG
- Recommended dilutions
- WB: 1:1,000-1:2,000, ELISA: 1 µg/ml (starting concentration)
- Molecular weight
- 74 kDa
- Antigen species
- Human
- Clonă
- ARC67668
- Secvență
- PFPSVASSAPPLTGKRGRGRPRKANLLDSMFGSPGGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSR
- Imunogen
- A recombinant fusion protein corresponding to amino acids 250-350 of human PATZ1.
Documentație
Produse similare
- Imagine indisponibilă
- Imagine indisponibilă
- Imagine indisponibilă
- Imagine indisponibilă
- Imagine indisponibilă
- Imagine indisponibilăAntibodiesA329719
Anti-P-Cadherin Antibody
3.161,13 – 10.581,45 lei2.612,50 – 8.745,00 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA329714
Anti-pan phospho-Threonine Antibody [ARC61310]
3.094,58 lei2.557,50 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA329720
Anti-P-Cadherin Antibody
3.161,13 – 10.581,45 lei2.612,50 – 8.745,00 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA329713
Anti-pan phospho-Tryptophan Antibody
3.094,58 lei2.557,50 leiTVA inclus (21%)fără TVA
- Imagine indisponibilă
- Imagine indisponibilă
- Imagine indisponibilă