Imagine indisponibilăAntibodiesA326328
Human Activin Receptor Type IA ELISA Kit
3.993,00 lei3.300,00 leiTVA inclus (21%)fără TVA
Anti-Activin Receptor Type IA Antibody [ARC2449]
Pe scurt
Anti-Activin Receptor Type IA Antibody [ARC2449] este un anticorp monoclonal de iepure împotriva țintei Activin Receptor Type IA, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA.
Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.
Descriere
Rabbit monoclonal [ARC2449] antibody to Activin Receptor Type IA.
Specificații
- Brand
- Antibodies
- Mărime
- 100µl
- Applications
- WB
- Reactivity
- Human, Mouse, Rat
- Conjugate
- Unconjugated
- Formulation
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
- Host
- Rabbit
- Clonality
- Monoclonal
- Product form
- Liquid
- Concentration
- Lot Specific
- Purification
- Affinity purification.
- Isotype
- IgG
- Recommended dilutions
- WB: 1:500-1:1,000
- Molecular weight
- 57 kDa
- Clonă
- ARC2449
- Secvență
- VLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC
- Imunogen
- A synthetic peptide corresponding to a sequence within amino acids 410-509 of human ACVR1 (Q04771).
Documentație
Produse similare
- Imagine indisponibilă
- Imagine indisponibilăAntibodiesA323875
Anti-Activin Receptor Type IA Antibody [DS-6016a] - Low endotoxin, Azide free
2.196,15 lei1.815,00 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA325574
Recombinant Human Activin Receptor Type IA Protein (C-terminal His Tag)
998,25 – 8.218,93 lei825,00 – 6.792,50 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA15772
Anti-Activin Receptor Type IA Antibody
2.662,00 lei2.200,00 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA7466
Human Activin Receptor Type IA ELISA Kit
3.959,73 – 5.190,90 lei3.272,50 – 4.290,00 leiTVA inclus (21%)fără TVA
- Imagine indisponibilă
- Imagine indisponibilă
- Imagine indisponibilăAntibodiesA309083
Anti-Fetal Hemoglobin Antibody [ARC1837]
3.094,58 lei2.557,50 leiTVA inclus (21%)fără TVA
- Imagine indisponibilă
- Imagine indisponibilăAntibodiesA309082
Anti-PKC alpha (phospho Thr638) Antibody [ARC1591]
3.094,58 lei2.557,50 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA309088
Anti-DKC1/Dyskerin Antibody [ARC1063]
3.094,58 lei2.557,50 leiTVA inclus (21%)fără TVA
- Imagine indisponibilăAntibodiesA309081
Anti-p53 (phospho Ser33) Antibody [ARC1528]
3.094,58 lei2.557,50 leiTVA inclus (21%)fără TVA