Imagine indisponibilăAnti-IRS1 Antibody [ARC0486]
Pe scurt
Anti-IRS1 Antibody [ARC0486] este un anticorp monoclonal de iepure împotriva țintei IRS1, cu reactivitate declarată pentru Human. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA.
Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.
Descriere
Rabbit monoclonal [ARC0486] antibody to IRS1.
Specificații
- Brand
- Antibodies
- Mărime
- 100µl
- Țintă
- IRS1
- Applications
- WB
- Reactivity
- Human
- Conjugate
- Unconjugated
- Formulation
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
- Host
- Rabbit
- Clonality
- Monoclonal
- Product form
- Liquid
- Concentration
- Lot Specific
- Purification
- Affinity purification.
- Isotype
- IgG
- Recommended dilutions
- WB: 1:500-1:2,000
- Molecular weight
- 170 kDa
- Clonă
- ARC0486
- Secvență
- SSETFSSTPSATRVGNTVPFGAGAAVGGGGGSSSSSEDVKRHSSASFENVWLRPGELGGAPKEPAKLCGAAGGLENGLNYIDLDLVKDFKQCPQECTPEPQ
- Imunogen
- A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human IRS1 (P35568).
Documentație
Produse similare
Imagine indisponibilă
Imagine indisponibilăAntibodiesA306239Anti-IRS1 (phospho Ser1101) Antibody
3.094,58 lei2.557,50 leiTVA inclus (21%)fără TVA
Imagine indisponibilăAntibodiesA316580Anti-IRS1 Antibody [IRS1/7571] - BSA and Azide free
4.924,70 lei4.070,00 leiTVA inclus (21%)fără TVA
Imagine indisponibilăAntibodiesA270978Rat IRS1 ELISA Kit
6.388,80 – 9.050,80 lei5.280,00 – 7.480,00 leiTVA inclus (21%)fără TVA
Imagine indisponibilăAntibodiesA103797IRS-1 (phospho Ser307) Cell Based ELISA Kit
4.625,23 lei3.822,50 leiTVA inclus (21%)fără TVA
Imagine indisponibilă
Imagine indisponibilăAntibodiesA102216IRS-1 (phospho Tyr896) Cell Based ELISA Kit
4.625,23 lei3.822,50 leiTVA inclus (21%)fără TVA
Imagine indisponibilăAntibodiesA102153IRS-1 (phospho Ser323) Cell Based ELISA Kit
4.625,23 lei3.822,50 leiTVA inclus (21%)fără TVA
Imagine indisponibilăAntibodiesA102151IRS-1 (phospho Ser612) Cell Based ELISA Kit
4.625,23 lei3.822,50 leiTVA inclus (21%)fără TVA
Imagine indisponibilăAntibodiesA102146IRS-1 (phospho Ser636) Cell Based ELISA Kit
4.625,23 lei3.822,50 leiTVA inclus (21%)fără TVA
Imagine indisponibilăAntibodiesA102145IRS-1 (phospho Ser312) Cell Based ELISA Kit
4.625,23 lei3.822,50 leiTVA inclus (21%)fără TVA
Imagine indisponibilăAntibodiesA102141IRS-1 (phospho Ser307) Cell Based ELISA Kit
4.625,23 lei3.822,50 leiTVA inclus (21%)fără TVA