# Synthetic Human Pramlintide Protein

**Cod produs:** A63495 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Synthetic Human Pramlintide Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63495, pentru ținta Pramlintide. Se livrează în mărimile 1mg, 5mg și 25mg, la prețuri între 1.730,30 și 5.523,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Pramlintide |
| Applications | SDS-PAGE |
| Formulation | Lyophilized without additives. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >98% as determined by RP-HPLC and SDS-PAGE. |
| Nature | Synthetic |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. This product is also soluble in 1% Acetic acid. |
| Secvență | KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY |
| Formulă moleculară | C171H267N51O53S2 |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 1mg | A63495-1 · 1.730,30 lei |
| 5mg | A63495-5 · 2.329,25 lei |
| 25mg | A63495-25 · 5.523,65 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63495.pdf)

---

Sursă: https://reactivi.ro/produs/synthetic-human-pramlintide-protein/ · actualizat 9 septembrie 2026