# Synthetic Human Leptin Protein

**Cod produs:** A63313 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Synthetic Human Leptin Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63313, pentru ținta Leptin. Se livrează în mărimile 200µg, 1mg și 5mg, la prețuri între 1.730,30 și 5.190,90 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Leptin |
| Formulation | Lyophilized without additives. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >95% as determined by RP-HPLC. |
| Nature | Synthetic |
| Protein species | Human |
| Reconstitution | Reconstitute with water or aqueous buffers. Very soluble in water and most aqueous buffers below and above the isoelectric point. |
| Protein Length | Protein fragment |
| Storage | Shipped at ambient temperature. Lyophilized: Short term store at 25°C. Long term store desiccated below -20°C. Reconstituted: Store at 4°C. |
| Secvență | CYFQNCPKPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQK |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 200µg | A63313-200 · 1.730,30 lei |
| 1mg | A63313-1 · 2.329,25 lei |
| 5mg | A63313-5 · 5.190,90 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63313.pdf)

---

Sursă: https://reactivi.ro/produs/synthetic-human-leptin-protein/ · actualizat 9 septembrie 2026