# Synthetic Human GLP-1 Protein

**Cod produs:** A63477 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Synthetic Human GLP-1 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63477, pentru ținta GLP-1. Se livrează în mărimile 4mg, 10mg și 50mg, la prețuri între 4.392,30 și 8.984,25 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | GLP-1 |
| Formulation | Lyophilized without additives. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >96% as determined by RP-HPLC. |
| Nature | Synthetic |
| Protein species | Human |
| Reconstitution | Reconstitute with a sterile 1% HCl solution to 0.1-1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-OH |
| Formulă moleculară | C153H225N43O49S |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 4mg | A63477-4 · 4.392,30 lei |
| 10mg | A63477-10 · 5.523,65 lei |
| 50mg | A63477-50 · 8.984,25 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63477.pdf)

---

Sursă: https://reactivi.ro/produs/synthetic-human-glp-1-protein/ · actualizat 9 septembrie 2026