# Synthetic Human GLP-1 Protein

**Cod produs:** A63491 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Synthetic Human GLP-1 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63491, pentru ținta GLP-1. Se livrează în mărimile 1mg, 5mg și 100mg, la prețuri între 1.730,30 și 17.868,68 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | GLP-1 |
| Formulation | Lyophilized without additives. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >96% as determined by RP-HPLC. |
| Nature | Synthetic |
| Protein species | Human |
| Reconstitution | Reconstitute with water at 0.5 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 1mg | A63491-1 · 1.730,30 lei |
| 5mg | A63491-5 · 2.329,25 lei |
| 100mg | A63491-100 · 17.868,68 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63491.pdf)

---

Sursă: https://reactivi.ro/produs/synthetic-human-glp-1-protein-2/ · actualizat 9 septembrie 2026