# Synthetic Human GHRH Protein

**Cod produs:** A63499 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Synthetic Human GHRH Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63499, pentru ținta GHRH. Se livrează în mărimile 250µg, 1mg și 5mg, la prețuri între 1.730,30 și 4.691,78 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | GHRH |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from a solution containing 0.1 mg Sodium Phosphate Monobasic and 1.6 mg Sodium Phosphate Dibasic. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >98% as determined by RP-HPLC and SDS-PAGE. |
| Nature | Synthetic |
| Protein species | Human |
| Protein Length | Protein fragment |
| Secvență | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 |
| Formulă moleculară | C149H246N 44O42S |
| Activitate biologică | Increases plasma growth hormone concentrations by directly stimulating the anterior pituitary gland to release natural human growth hormone. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 250µg | A63499-250 · 1.730,30 lei |
| 1mg | A63499-1 · 2.329,25 lei |
| 5mg | A63499-5 · 4.691,78 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63499.pdf)

---

Sursă: https://reactivi.ro/produs/synthetic-human-ghrh-protein/ · actualizat 9 septembrie 2026