# Synthetic Human Cathelicidin/CLP Protein

**Cod produs:** A325796 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Synthetic Human Cathelicidin/CLP Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A325796, pentru ținta Cathelicidin/CLP. Se livrează în mărimile 10mg, 50mg și 200mg, la prețuri între 5.057,80 și 12.178,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Cathelicidin/CLP |
| Formulation | Lyophilized without additives. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >97% as determined by RP-HPLC. |
| Nature | Synthetic |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Secvență | H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH |
| Formulă moleculară | C205H340N60O53 |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 10mg | A325796-10 · 5.057,80 lei |
| 50mg | A325796-50 · 7.453,60 lei |
| 200mg | A325796-200 · 12.178,65 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/325/A325796.pdf)

---

Sursă: https://reactivi.ro/produs/synthetic-human-cathelicidin-clp-protein/ · actualizat 9 septembrie 2026