# Synthetic Human BNP Protein

**Cod produs:** A61837 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Synthetic Human BNP Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61837, pentru ținta BNP. Se livrează în mărimile 10mg, 25mg și 100mg, la prețuri între 3.859,90 și 14.108,60 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | BNP |
| Formulation | Lyophilized without additives. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >95% as determined by RP-HPLC. |
| Nature | Synthetic |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
| Formulă moleculară | C143H244N50O42S4 |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 10mg | A61837-10 · 3.859,90 lei |
| 25mg | A61837-25 · 5.523,65 lei |
| 100mg | A61837-100 · 14.108,60 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61837.pdf)

---

Sursă: https://reactivi.ro/produs/synthetic-human-bnp-protein/ · actualizat 9 septembrie 2026
