# Synthetic Human Amyloid beta 1-40

**Cod produs:** A320589 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Synthetic Human Amyloid beta 1-40 este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A320589, pentru ținta Amyloid beta 1-40. Se livrează în mărimea 1mg, la prețul de 3.993,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Amyloid beta 1-40 |
| Applications | ELISA |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | 100% (by HPLC). |
| Nature | Synthetic |
| Protein species | Human |
| Reconstitution | Reconstitute with 1 ml deionised water. |
| Protein Length | 40 |
| Secvență | MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGR |
| Aminoacizi | aa 1 - 40 |
| Specificitate | Synthetic Human beta amyloid 1-40 peptide is a synthetic peptide corresponding to full-length human beta amyloid 40, a major component of amyloid plaques. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 1mg | A320589-1 · 3.993,00 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/320/A320589.pdf)

---

Sursă: https://reactivi.ro/produs/synthetic-human-amyloid-beta-1-40/ · actualizat 9 septembrie 2026