# Synthetic Gila Monster Exendin 4 Protein

**Cod produs:** A63514 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Synthetic Gila Monster Exendin 4 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63514, pentru ținta Exendin 4. Se livrează în mărimile 1mg, 10mg și 50mg, la prețuri între 2.994,75 și 20.929,98 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Exendin 4 |
| Applications | SDS-PAGE |
| Formulation | Lyophilized without additives. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >99% as determined by RP-HPLC and SDS-PAGE. |
| Nature | Synthetic |
| Protein species | Gila Monster |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Formulă moleculară | C184H282N50O60S |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 1mg | A63514-1 · 2.994,75 lei |
| 10mg | A63514-10 · 8.984,25 lei |
| 50mg | A63514-50 · 20.929,98 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63514.pdf)

---

Sursă: https://reactivi.ro/produs/synthetic-gila-monster-exendin-4-protein/ · actualizat 9 septembrie 2026