# Recombinant Zebrafish Growth Hormone Protein

**Cod produs:** A63317 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Zebrafish Growth Hormone Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63317, pentru ținta Growth Hormone. Se livrează în mărimile 10µg, 50µg și 1mg, la prețuri între 1.730,30 și 20.730,33 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Growth Hormone |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from a solution containing 0.5% Sodium Bicarbonate, pH 8. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >99% as determined by SEC-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Zebrafish |
| Secvență | AQRLFNNAVIRVQHLHQLAAKMINDFEEGLMPEERRQLSKIFPLSFCNSDSIETPTGKDETQKSSMLKLLRISFRLIESWEFPSQTLSSTISNSLTIGNPNLITEKLVDLKMGISVLIKGCLDGQPNMDDNDSLPLPFEDFYLTVGETSLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL |
| Activitate biologică | Bologically active in PDF-P1 3B9 cells stably transfected with rabbit GH receptors. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 10µg | A63317-10 · 1.730,30 lei |
| 50µg | A63317-50 · 2.329,25 lei |
| 1mg | A63317-1 · 20.730,33 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63317.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-zebrafish-growth-hormone-protein-2/ · actualizat 9 septembrie 2026