# Recombinant Tilapia Leptin A Protein

**Cod produs:** A113614 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Tilapia Leptin A Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A113614, pentru ținta Leptin A. Se livrează în mărimile 20µg, 100µg și 1mg, la prețuri între 1.730,30 și 11.513,15 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Leptin A |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from a solution containing Sodium Bicarbonate at 1:2 - salt:protein ratio. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >95% as determined by Gel Filtration and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Tilapia |
| Reconstitution | Reconstitute with water or 0.4% Sodium Bicarbonate adjusted to pH 8-9, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Full length protein. |
| Secvență | MDYGLVLLFSLFQALSMGTAAPLPVEVVTMKSKVKWMAEQLVVRLDKDVQVPVNWTLNPPADDLDGTSSIVTVLNGYNSLIPDTFKGVSQIKYDISSLTGYIHLWRQGHCSEQRPKPEVPGPLQELQSHKEFIQTVGIEALMRVKEFLNLLLKNLDQLETC |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A113614-20 · 1.730,30 lei |
| 100µg | A113614-100 · 2.329,25 lei |
| 1mg | A113614-1 · 11.513,15 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/113/A113614.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-tilapia-leptin-a-protein/ · actualizat 9 septembrie 2026
