# Recombinant Streptomyces avidinii Streptavidin Protein

**Cod produs:** A60061 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Streptomyces avidinii Streptavidin Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A60061, pentru ținta Streptavidin. Se livrează în mărimile 5mg, 20mg și 1g, la prețuri între 1.730,30 și 31.112,13 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Streptavidin |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from 10 mM Potassium Phosphate Buffered Saline, pH 6.5. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >98% as determined by SDS-PAGE and HPLC. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Streptomyces avidinii |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.5 mg/ml, which can then be further diluted to other aqueous solutions. |
| Storage | Shipped at ambient temperature. Store at -20°C. |
| Secvență | MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS |
| Definiția unității | One unit is defined as the amount of protein that binds 1 µg D-biotin. |
| Activitate biologică | >17 U/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 5mg | A60061-5 · 1.730,30 lei |
| 20mg | A60061-20 · 2.329,25 lei |
| 1g | A60061-1 · 31.112,13 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/60/A60061.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-streptomyces-avidinii-streptavidin-protein-2/ · actualizat 9 septembrie 2026