# Recombinant Rat VEGFC Protein (C-terminal His Tag)

**Cod produs:** A63378 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Rat VEGFC Protein (C-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63378, pentru ținta VEGFC. Se livrează în mărimile 2µg, 10µg și 1mg, la prețuri între 1.730,30 și 52.341,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | VEGFC |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from Phosphate Buffered Saline with 50 mg BSA. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >90% as determined by SDS-PAGE. |
| Expression system | Baculovirus infected Sf9 cells |
| Nature | Recombinant |
| Protein species | Rat |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A63378-2 · 1.730,30 lei |
| 10µg | A63378-10 · 2.329,25 lei |
| 1mg | A63378-1 · 52.341,58 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63378.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-rat-vegfc-protein-c-terminal-his-tag-2/ · actualizat 9 septembrie 2026
