# Recombinant Rat Leptin Protein

**Cod produs:** A331721 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Rat Leptin Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331721, pentru ținta Leptin. Se livrează în mărimile 50µg și 100µg, la prețuri între 1.297,73 și 1.563,93 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Leptin |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >97% (by SDS-PAGE). |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Rat |
| Endotoxin level | <0.1 EU/µg. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | VPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC |
| Activitate biologică | Immobilized Human LEPR (5 µg/mL) bind Rat LEP in a functional ELISA with a linear range of 1-530 ng/mL. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 50µg | A331721-50 · 1.297,73 lei |
| 100µg | A331721-100 · 1.563,93 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331721.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-rat-leptin-protein-2/ · actualizat 9 septembrie 2026
