# Recombinant Rat IL-1RA Protein

**Cod produs:** A331675 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Rat IL-1RA Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331675, pentru ținta IL-1ra. Se livrează în mărimile 20µg și 50µg, la prețuri între 1.996,50 și 2.861,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | IL-1ra |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >92% (by SDS-PAGE). |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Rat |
| Endotoxin level | <1 EU/µg. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | HPAGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNTKLEEKIDMVPIDFRNVFLGIHGGKLCLSCVKSGDDTKLQLEEVNITDLNKNKEEDKRFTFIRSETGPTTSFESLACPGWFLCTTLEADHPVSLTNTPKEPCTVTKFYFQEDQ |
| Activitate biologică | Inhibition of IL-1 alpha-dependent proliferation in D10.G4.1 mouse helper T cells: ED50 = 2.62-10.48ng/mL in the presence of 50 pg/mL of rrIL-1 alpha; Specific activity = 9.54×10^4~3.82×10^5 units/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A331675-20 · 1.996,50 lei |
| 50µg | A331675-50 · 2.861,65 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331675.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-rat-il-1ra-protein-2/ · actualizat 9 septembrie 2026