# Recombinant Rat IL-1 beta Protein

**Cod produs:** A61594 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Rat IL-1 beta Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61594, pentru ținta IL-1 beta. Se livrează în mărimile 2µg, 10µg și 1mg, la prețuri între 1.730,30 și 41.460,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | IL-1 beta |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4, with 0.02% Tween 20 and 5% Trehalose. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >96% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Rat |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS |
| Activitate biologică | ED50: <0.1 ng/ml, as determined by the dose dependent proliferation of mouse D10S cells, corresponding to a specific activity of 10,000,000 U/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A61594-2 · 1.730,30 lei |
| 10µg | A61594-10 · 2.329,25 lei |
| 1mg | A61594-1 · 41.460,65 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61594.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-rat-il-1-beta-protein/ · actualizat 9 septembrie 2026