# Recombinant Rat IL-1 beta Protein (C-terminal His Tag)

**Cod produs:** A330796 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Rat IL-1 beta Protein (C-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330796, pentru ținta IL-1 beta. Se livrează în mărimile 10µg și 20µg, la prețuri între 1.563,93 și 1.996,50 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | IL-1 beta |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 85% by SDS-PAGE. |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Rat |
| Endotoxin level | <1 EU/µg. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS |
| Activitate biologică | Cell proliferation of the D10.G4.1 mouse helper T cell line: ED50 = 0.68-2.72ng/mL; Specific activity = 3.68×10^5~1.47×10^6 units/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 10µg | A330796-10 · 1.563,93 lei |
| 20µg | A330796-20 · 1.996,50 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330796.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-rat-il-1-beta-protein-c-terminal-his-tag/ · actualizat 9 septembrie 2026