# Recombinant Rat CNTF Protein

**Cod produs:** A63604 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Rat CNTF Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63604, pentru ținta CNTF. Se livrează în mărimile 5µg, 25µg și 1mg, la prețuri între 1.730,30 și 24.423,85 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | CNTF |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from a solution containing 0.025% Sodium Bicarbonate. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >99% as determined by Gel Filtration and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Rat |
| Protein Length | Full length protein. |
| Secvență | AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM |
| Activitate biologică | Fully biologically active by its ability to phosphorylate STAT3 in several cells lines. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 5µg | A63604-5 · 1.730,30 lei |
| 25µg | A63604-25 · 2.329,25 lei |
| 1mg | A63604-1 · 24.423,85 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63604.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-rat-cntf-protein/ · actualizat 9 septembrie 2026