# Recombinant Rat CD47 Protein (C-terminal Human Fc Tag)

**Cod produs:** A330350 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Rat CD47 Protein (C-terminal Human Fc Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330350, pentru ținta CD47. Se livrează în mărimile 20µg și 50µg, la prețuri între 1.730,30 și 2.262,70 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | CD47 |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >97% (by SDS-PAGE). |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Rat |
| Endotoxin level | <0.1 EU/µg. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | QLLLSKVKSVEFTSCNDTVVIPCKVLNVEAQSTDEMFVKWKLNKSYIFIYDGNKNSTTREQNFTSAKISVSDLLKGIASLTMDTHEAVVGNYTCEVTELSREGKTVIELKNRPVSWFSTNEK |
| Activitate biologică | Immobilized Human CD172a (2 µg/mL) bind Human CD47 in a functional ELISA with a linear range of 19.5-3491.5ng/mL. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A330350-20 · 1.730,30 lei |
| 50µg | A330350-50 · 2.262,70 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330350.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-rat-cd47-protein-c-terminal-human-fc-tag/ · actualizat 9 septembrie 2026
