# Recombinant Pufferfish Leptin Protein

**Cod produs:** A63146 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Pufferfish Leptin Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63146, pentru ținta Leptin. Se livrează în mărimile 20µg, 100µg și 1mg, la prețuri între 1.730,30 și 11.513,15 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Leptin |
| Applications | Cell Proliferation Assay |
| Formulation | Lyophilized from a solution containing 3 µM Sodium Bicarbonate. |
| Product form | Lyophilized |
| Concentration | 0.85 mg/mL |
| Purity | >99% as determined by SEC-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Pufferfish |
| Reconstitution | Reconstitute with 0.4% Sodium Bicarbonate, pH 9, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Secvență | ALPGALDAMDVEKMKSKVTWKAQGLVARIDKHFPDRGLRFDTDKVEGSTSVVASLESYNNLISDRFGGVSQIKTEISSLAGYLNHWREGNCQEQQPKVWPRRNIFNHTVSLEALMRVREFLKLLQKNVDLLERC |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A63146-20 · 1.730,30 lei |
| 100µg | A63146-100 · 2.329,25 lei |
| 1mg | A63146-1 · 11.513,15 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63146.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-pufferfish-leptin-protein/ · actualizat 9 septembrie 2026