# Recombinant Oyster mushroom Ostreolysin Protein

**Cod produs:** A113445 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Oyster mushroom Ostreolysin Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A113445, pentru ținta Ostreolysin. Se livrează în mărimile 5µg, 20µg și 1mg, la prețuri între 998,25 și 17.868,68 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Ostreolysin |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from a solution containing 0.02% Sodium Bicarbonate. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >98% as determined by Gel Filtration and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Oyster mushroom |
| Reconstitution | Reconstitute with 0.4% Sodium Bicarbonate, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Full length protein. |
| Secvență | AYAQWVIILIHNVGQQNVKIKNLNASWGKLYADGDKDTEVPASKYEGMVIAPGDQVQINACGREDAAEGTTGTFDLVDPNDSDKQVRHISWDCPWGTKANSWVVGGSNSKWMIEYTGQNLDSGALGTITVNTLKIGN |
| Activitate biologică | Ostreolysin has potent anti-carcinogenic activity in several colon cancer cell lines. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 5µg | A113445-5 · 998,25 lei |
| 20µg | A113445-20 · 1.963,23 lei |
| 1mg | A113445-1 · 17.868,68 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/113/A113445.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-oyster-mushroom-ostreolysin-protein/ · actualizat 9 septembrie 2026