# Recombinant Mouse TWEAK Protein (C-terminal Rabbit Fc Tag)

**Cod produs:** A331911 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse TWEAK Protein (C-terminal Rabbit Fc Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331911, pentru ținta TWEAK. Se livrează în mărimea 50µg, la prețul de 2.861,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | TWEAK |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 90% (by SDS-PAGE) |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Mouse |
| Endotoxin level | <1 EU/µg. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | RAIAAHYEVHPRPGQDGAQAGVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQVHFDEGKAVYLKLDLLVNGVLALRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH |
| Activitate biologică | Inhibition of cell proliferation for human umbilical vein endothelial cells (HUVEC): ED50 = typically 10-50ng/mL. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 50µg | A331911-50 · 2.861,65 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331911.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-tweak-protein-c-terminal-rabbit-fc-tag/ · actualizat 9 septembrie 2026