# Recombinant Mouse TSLP Protein (C-terminal Human Fc Tag)

**Cod produs:** A331878 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse TSLP Protein (C-terminal Human Fc Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331878, pentru ținta TSLP. Se livrează în mărimile 10µg și 50µg, la prețuri între 1.364,28 și 2.528,90 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | TSLP |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.2µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Mouse |
| Reconstitution | Reconstitute with distilled sterile water to a concentration of 0.1-0.5 mg/mL. |
| Endotoxin level | <1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 10µg | A331878-10 · 1.364,28 lei |
| 50µg | A331878-50 · 2.528,90 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331878.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-tslp-protein-c-terminal-human-fc-tag/ · actualizat 9 septembrie 2026