# Recombinant Mouse/Rat Latent TGF-beta 2 Protein

**Cod produs:** A331747 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse/Rat Latent TGF-beta 2 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331747, pentru ținta Latent TGF-beta 2. Se livrează în mărimile 20µg și 50µg, la prețuri între 2.662,00 și 4.558,68 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Latent TGF-beta 2 |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from 4mM HCl (0.2µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Mouse |
| Endotoxin level | <1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHTKVLSLYNTINPEASASPCCVSQDLEPLTILYYIGNTPKIEQLSNMIVKSCKCS |
| Activitate biologică | Inhibition of the IL-4-dependent proliferation of HT-2 mouse T cells: ED50 = 0.062-0.248ng/mL; Specific activity = 4.03×106~1.61×107 units/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A331747-20 · 2.662,00 lei |
| 50µg | A331747-50 · 4.558,68 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331747.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-rat-latent-tgf-beta-2-protein/ · actualizat 9 septembrie 2026