# Recombinant Mouse PTN Protein (C-terminal His Tag)

**Cod produs:** A331798 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse PTN Protein (C-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331798, pentru ținta PTN. Se livrează în mărimile 10µg și 50µg, la prețuri între 1.464,10 și 2.861,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | PTN |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.2µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Mouse |
| Reconstitution | Reconstitute with distilled sterile water to a concentration of 0.1-0.5 mg/mL. |
| Endotoxin level | <1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNADCQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD |
| Activitate biologică | Ability to enhance neurite outgrowth of E16-E18 rat embryonic cerebral cortical neurons: 3-8µg/mL. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 10µg | A331798-10 · 1.464,10 lei |
| 50µg | A331798-50 · 2.861,65 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331798.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-ptn-protein-c-terminal-his-tag/ · actualizat 9 septembrie 2026
