# Recombinant Mouse PLGF Protein (C-terminal Human Fc and His Tag)

**Cod produs:** A331796 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse PLGF Protein (C-terminal Human Fc and His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331796, pentru ținta PLGF. Se livrează în mărimea 20µg, la prețul de 2.262,70 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | PLGF |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >87% (by SDS-PAGE). |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Mouse |
| Endotoxin level | <1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | MLVMKLFTCFLQVLAGLAVHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP |
| Activitate biologică | Immobilized Recombinant Human VEGFR1 (500 ng/mL) bind Recombinant Mouse PLGF in a functional ELISA with a linear range of 12-49 ng/mL. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A331796-20 · 2.262,70 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331796.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-plgf-protein-c-terminal-human-fc-and-his-tag/ · actualizat 9 septembrie 2026