# Recombinant Mouse PDGF-BB Protein (C-terminal His Tag)

**Cod produs:** A331791 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse PDGF-BB Protein (C-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331791, pentru ținta PDGF BB. Se livrează în mărimile 20µg și 50µg, la prețuri între 1.996,50 și 2.861,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | PDGF BB |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from 20mM NaAc-Hac, pH 4.5 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >97% (by SDS-PAGE). |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Mouse |
| Endotoxin level | <1 EU/µg. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT |
| Activitate biologică | Immobilized Human PDGFB (2 µg/mL) bind Human PDGFRB in a functional ELISA with a linear range of 12-153 ng/mL. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A331791-20 · 1.996,50 lei |
| 50µg | A331791-50 · 2.861,65 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331791.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-pdgf-bb-protein-c-terminal-his-tag/ · actualizat 9 septembrie 2026