# Recombinant Mouse PDGF AA Protein (N-terminal His Tag)

**Cod produs:** A331790 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse PDGF AA Protein (N-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331790, pentru ținta PDGF AA. Se livrează în mărimea 50µg, la prețul de 4.858,15 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | PDGF AA |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from 0.1% TFA with 30% CAN (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | Pichia |
| Nature | Recombinant |
| Protein species | Mouse |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRR |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 50µg | A331790-50 · 4.858,15 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331790.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-pdgf-aa-protein-n-terminal-his-tag/ · actualizat 9 septembrie 2026