# Recombinant Mouse PD1 Protein (C-terminal Human Fc Tag)

**Cod produs:** A331789 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse PD1 Protein (C-terminal Human Fc Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331789, pentru ținta PD1. Se livrează în mărimea 20µg, la prețul de 1.364,28 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | PD1 |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Mouse |
| Endotoxin level | <0.1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A331789-20 · 1.364,28 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331789.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-pd1-protein-c-terminal-human-fc-tag/ · actualizat 9 septembrie 2026