# Recombinant Mouse NGF Protein

**Cod produs:** A331484 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse NGF Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331484, pentru ținta NGF. Se livrează în mărimea 10µg, la prețul de 1.430,83 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | NGF |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from 20mM Tris, pH 8.0, with 150mM NaCl (0.2µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Mouse |
| Endotoxin level | <1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 10µg | A331484-10 · 1.430,83 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331484.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-ngf-protein/ · actualizat 9 septembrie 2026