# Recombinant Mouse M-CSF Protein

**Cod produs:** A331532 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse M-CSF Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331532, pentru ținta M-CSF. Se livrează în mărimile 20µg și 50µg, la prețuri între 2.628,73 și 3.760,08 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | M-CSF |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Mouse |
| Endotoxin level | <0.01 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | MTARGAAGRCPSSTWLGSRLLLVCLLMSRSIAKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP |
| Activitate biologică | Inhibition of cell proliferation for M-NFS-60 mouse myelogenous leukemia lymphoblast cells: ED50 = 3.76-15.16ng/mL; Specific activity = 6.6×10^4~2.65×10^5 units/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A331532-20 · 2.628,73 lei |
| 50µg | A331532-50 · 3.760,08 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331532.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-m-csf-protein-2/ · actualizat 9 septembrie 2026