# Recombinant Mouse LIF Protein

**Cod produs:** A61848 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse LIF Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61848, pentru ținta LIF. Se livrează în mărimile 3 x 2µg, 25µg și 1mg, la prețuri între 1.730,30 și 22.627,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | LIF |
| Applications | Cell Proliferation Assay |
| Formulation | Lyophilized from 20 mM Phosphate Buffered Saline, pH 7.4, with 0.02% Tween 20. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >95% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Mouse |
| Reconstitution | Reconstitute with water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF |
| Definiția unității | 50 units is defined as the concentration of mouse LIF in 1 mL of tissue culture medium that induces the differentiation of 50% of M1 colonies. |
| Activitate biologică | <0.01 ng/ml, corresponding to a specific activity of 100,000,000 IU/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 3 x 2µg | A61848-32 · 1.730,30 lei |
| 25µg | A61848-25 · 2.329,25 lei |
| 1mg | A61848-1 · 22.627,00 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61848.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-lif-protein/ · actualizat 9 septembrie 2026