# Recombinant Mouse LIF Protein (C-terminal His and Avi Tag)

**Cod produs:** A331725 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse LIF Protein (C-terminal His and Avi Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331725, pentru ținta LIF. Se livrează în mărimile 20µg și 50µg, la prețuri între 1.896,68 și 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | LIF |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 90% (by SDS-PAGE) |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Mouse |
| Endotoxin level | <0.1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF |
| Activitate biologică | Inhibition of cell proliferation for TF-1 Human erythroleukemic cells: ED50 = 35.675-142.7ng/mL; Specific activity = 7.00×10^4~2.80×10^4 units/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A331725-20 · 1.896,68 lei |
| 50µg | A331725-50 · 2.662,00 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331725.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-lif-protein-c-terminal-his-and-avi-tag/ · actualizat 9 septembrie 2026