# Recombinant Mouse Leptin Protein

**Cod produs:** A331943 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse Leptin Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331943, pentru ținta Leptin. Se livrează în mărimea 100µg, la prețul de 1.563,93 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Leptin |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from 20mM PB, pH 7.4, with 300mM NaCl (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Mouse |
| Endotoxin level | <1 EU/µg. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | VPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC |
| Activitate biologică | Immobilized mouse Leptin/LEP (0.5 µg/mL) bind human LEP-R/CD295 in a functional ELISA with a linear range of 0.34-70.6 ng/mL. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µg | A331943-100 · 1.563,93 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331943.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-leptin-protein-2/ · actualizat 9 septembrie 2026