# Recombinant Mouse Latent TGF-beta 1 Protein

**Cod produs:** A331746 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse Latent TGF-beta 1 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331746, pentru ținta Latent TGF beta 1. Se livrează în mărimile 20µg și 50µg, la prețuri între 2.662,00 și 4.192,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Latent TGF beta 1 |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from 50mM Glycine, pH3.5, with 150mM NaCl (0.2µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Mouse |
| Endotoxin level | <0.01 EU/µg. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
| Activitate biologică | Inhibition of the IL-4-dependent proliferation of HT-2 Mouse T cells: ED50 = 0.054-0.214ng/mL; Specific activity = 4.7×10^6~1.85×10^7 units/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A331746-20 · 2.662,00 lei |
| 50µg | A331746-50 · 4.192,65 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331746.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-latent-tgf-beta-1-protein/ · actualizat 9 septembrie 2026