# Recombinant Mouse KGF Protein

**Cod produs:** A331595 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse KGF Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331595, pentru ținta KGF. Se livrează în mărimile 20µg și 50µg, la prețuri între 1.996,50 și 2.861,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | KGF |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4, with 8% Trehalose (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Mouse |
| Endotoxin level | <1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | CNDMSPEQTATSVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTKKEQKTAHFLPMAIT |
| Activitate biologică | Inhibition of cell proliferation for BaF3 mouse pro-B cells transfected with human FGFR2b: ED50 = typically 20-100ng/mL |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A331595-20 · 1.996,50 lei |
| 50µg | A331595-50 · 2.861,65 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331595.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-kgf-protein/ · actualizat 9 septembrie 2026