# Recombinant Mouse IL-25 Protein

**Cod produs:** A61719 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse IL-25 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61719, pentru ținta IL-25. Se livrează în mărimile 5µg, 25µg și 1mg, la prețuri între 1.730,30 și 24.423,85 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | IL-25 |
| Applications | SDS-PAGE |
| Formulation | Lyophilized without additives. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >95% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Mouse |
| Reconstitution | Reconstitute with 10 mM HCl at a concentration, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA |
| Activitate biologică | The activity is determined by the dose-dependent production of IL-8 by human PBMCs and is 322-488 ng/ml. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 5µg | A61719-5 · 1.730,30 lei |
| 25µg | A61719-25 · 2.329,25 lei |
| 1mg | A61719-1 · 24.423,85 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61719.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-il-25-protein/ · actualizat 9 septembrie 2026
