# Recombinant Mouse IL-11 Protein

**Cod produs:** A330808 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse IL-11 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330808, pentru ținta IL-11. Se livrează în mărimile 10µg și 20µg, la prețuri între 2.096,33 și 2.861,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | IL-11 |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Mouse |
| Endotoxin level | <1 EU/µg. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
| Activitate biologică | Inhibition of cell proliferation for TF-1 Human erythroleukemic cells: ED50 = 2.64-10.56ng/mL; Specific activity = 9.47×10^4~3.79×10^5 units/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 10µg | A330808-10 · 2.096,33 lei |
| 20µg | A330808-20 · 2.861,65 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330808.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-il-11-protein-2/ · actualizat 9 septembrie 2026