# Recombinant Mouse Flt3 ligand/Flt3L Protein (C-terminal Human Fc and His Tag)

**Cod produs:** A330660 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse Flt3 ligand/Flt3L Protein (C-terminal Human Fc and His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330660, pentru ținta Flt3 Ligand/Flt3L. Se livrează în mărimile 20µg și 50µg, la prețuri între 1.896,68 și 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Flt3 Ligand/Flt3L |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 85% by SDS-PAGE. |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Mouse |
| Endotoxin level | <0.1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPR |
| Activitate biologică | Immobilized Recombinant Mouse FLT3, His Tag (3 µg/mL) bind Recombinant Mouse Flt-3 Ligand in a functional ELISA: EC50 = 36 ng/mL. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A330660-20 · 1.896,68 lei |
| 50µg | A330660-50 · 2.662,00 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330660.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-flt3-ligand-flt3l-protein-c-terminal-human-fc-and-his-tag/ · actualizat 9 septembrie 2026