# Recombinant Mouse FIGF Protein (C-terminal His Tag)

**Cod produs:** A331937 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse FIGF Protein (C-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331937, pentru ținta FIGF. Se livrează în mărimea 100µg, la prețul de 4.192,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | FIGF |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4, with 8% Trehalose (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Mouse |
| Endotoxin level | <0.1 EU/µg. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | YDTETLKVIDEEWQRTQCSPRETCVEVASELGKTTNTFFKPPCVNVFRCGGCCNEEGVMCMNTSTSYISKQLFEISVPLTSVPELVPVKIANHTGCKCLPTGPRHPYS |
| Activitate biologică | Immobilized Mouse VEGFD(5 µg/mL) bind Human VEGFR-3/FLT-4 in a functional ELISA with a linear range of 0.5-67.73 ng/mL. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µg | A331937-100 · 4.192,65 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331937.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-figf-protein-c-terminal-his-tag/ · actualizat 9 septembrie 2026