# Recombinant Mouse FGF2 Protein (C-terminal His Tag)

**Cod produs:** A331592 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse FGF2 Protein (C-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331592, pentru ținta FGF2. Se livrează în mărimile 20µg și 50µg, la prețuri între 1.197,90 și 1.730,30 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | FGF2 |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Mouse |
| Endotoxin level | <0.1 EU/µg. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Activitate biologică | Maintenance of the cellular characteristics of DP cells via immunofluorescence identification: 1 ng/mL; Note: red is fluorescently labeled PDFGRA antibody and blue-cyan is DAPI-stained cells. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A331592-20 · 1.197,90 lei |
| 50µg | A331592-50 · 1.730,30 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331592.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-fgf2-protein-c-terminal-his-tag/ · actualizat 9 septembrie 2026