# Recombinant Mouse FGF1 Protein

**Cod produs:** A331589 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse FGF1 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331589, pentru ținta FGF1. Se livrează în mărimile 20µg și 50µg, la prețuri între 1.796,85 și 2.462,35 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | FGF1 |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from 20mM Tris-HCl, pH 7.5, wth 50mM Na2SO4, 0.5mM DTT, and 1mM EDTA (0.2µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Mouse |
| Endotoxin level | <0.1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A331589-20 · 1.796,85 lei |
| 50µg | A331589-50 · 2.462,35 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331589.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-fgf1-protein/ · actualizat 9 septembrie 2026